PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00008.1.g02920.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 169aa    MW: 19023.5 Da    PI: 10.1394
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00008.1.g02920.1.am.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.31.5e-271867251
                         G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                                    pr+rWt+eLH++Fv+ave LGG+++AtPk+il+lm+vkg++++h+kSHLQ
  Zjn_sc00008.1.g02920.1.am.mkhc 18 PRMRWTEELHRQFVKAVECLGGPDEATPKRILQLMGVKGVSISHIKSHLQ 67
                                    8************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.8231474IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-251467IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-221868IPR006447Myb domain, plants
SuperFamilySSF466891.18E-141868IPR009057Homeodomain-like
PfamPF002491.7E-71967IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MRGFERKGVR QYNRSEVPRM RWTEELHRQF VKAVECLGGP DEATPKRILQ LMGVKGVSIS  60
HIKSHLQASH QKSISATASN SKRVFWSRED HCVYASDHDG NAASSDKNIC AMLLRNCSHS  120
PQYQTPSLKQ VFGNWEQSSG GRPPRHSSSM LTPGKVTQHF SEYGDAIKL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4067631e-74CU406763.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C005B16, full insert sequence.
GenBankEU9560371e-74EU956037.1 Zea mays clone 1555999 myb-like DNA-binding domain, SHAQKYF class family protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966301.11e-66PREDICTED: uncharacterized protein LOC101769616
TrEMBLK3XZ211e-66K3XZ21_SETIT; Uncharacterized protein
STRINGSi007179m3e-66(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54933758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.12e-24G2-like family protein